SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9SB15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9SB15
Domain Number - Region: 71-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz beta-1 subunit 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9SB15
Sequence length 200
Comment (tr|Q9SB15|Q9SB15_9CARY) Transcarboxylase-beta {ECO:0000313|EMBL:BAA34829.1} OX=62329 OS=Fagopyrum cymosum. GN=accD OC=Fagopyrum.
Sequence
MEKWWFNSMLSKEELEDRCGLSKSMDSDNINSNENMILNFTEKSIHSWSNGSSYSNLDLL
FAIGDIPNLISDETFLIRDHKGETYSVYFDIENKIVEIDNYHSFSNYWNSSYGTGSKSND
THYDLYMYDTKSSLNNHINGCIDSYLHSQMRIDNFVLRDIDHYGDNYIFDESKTTTKTNG
RDKNLEVTQKYRNLWIQCEN
Download sequence
Identical sequences Q9SB15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]