SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UWX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9UWX5
Domain Number - Region: 76-105
Classification Level Classification E-value
Superfamily Vanabin-like 0.0562
Family Vanabin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9UWX5
Sequence length 173
Comment (tr|Q9UWX5|Q9UWX5_SULSF) Uncharacterized protein ORF-c21_027 {ECO:0000313|EMBL:CAB57728.1} OX=2287 OS=Sulfolobus solfataricus. GN=ORF-c21_027 OC=Sulfolobus.
Sequence
MPNCIMREPFLSISIKEPFMNLTPLIISLAILFTSTDNIGLFERFTNFQFPGLPFFALGT
VSSFMCKLIVSSSKKLSNDKLCSNGCKKLYCIPITSQIFFCVSSAVTIMQPFSKQYSRES
SLASPFFEFSPTISKLTRILSVISFNFFTSSRAISALTKPSLLSFSSSAKSDL
Download sequence
Identical sequences Q9UWX5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]