SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UY06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UY06
Domain Number 1 Region: 55-211
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000549
Family LacY-like proton/sugar symporter 0.033
Further Details:      
 
Weak hits

Sequence:  Q9UY06
Domain Number - Region: 224-296
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.00248
Family Arp2/3 complex 16 kDa subunit ARPC5 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UY06
Sequence length 353
Comment (tr|Q9UY06|Q9UY06_PYRAB) Uncharacterized protein {ECO:0000313|EMBL:CAB50606.1} KW=Complete proteome OX=272844 OS=Pyrococcus abyssi (strain GE5 / Orsay). GN=PAB1116 OC=Pyrococcus.
Sequence
MITDLVPYLNLLSRLILFISSSYKAVKTRDSGWIILSFAFLLPILDIEEFILAPLNVEVK
ENNILNVIPNFYYAILFTMAGTLIRYRRITAKTSMIIGSTLLIAQILMFGNATKAINTLV
VSIIAYLGYGLSMVYLGFVLISHSRGTIETLFPIGTIGVGLLNLTYPITSNIPILSTSFF
TLAAIFRFMAAIGAIKMIILIPEEPRKSKRTKGLQPGAYWTESKKGALELISQSNPVIIT
RRNPLDINFPAAIYWITKAKEGKIRENVYAISPTKIDILIDLINRAFEMGYKTLYIDCLE
YLALENGTNATLKFLYTIKDIITKHNGVILLALNPKTFEEREVKMIEKEFKKI
Download sequence
Identical sequences Q9UY06
WP_010868820.1.84333 gi|14521900|ref|NP_127377.1| 272844.PAB1116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]