SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9WYJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9WYJ6
Domain Number - Region: 32-78
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.068
Family ERP29 C domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9WYJ6
Sequence length 113
Comment (tr|Q9WYJ6|Q9WYJ6_THEMA) Uncharacterized protein {ECO:0000313|EMBL:AAD35448.1} KW=Complete proteome; Reference proteome OX=243274 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099). GN=TM_0361 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MHGGDIVWITALVVLGFTLYSFYTWAFLVRHRKIISYIEREILELEEREKLFRREVVSGN
DFVKEKYEKILKLLEKAREDYNFEVEKFNRKLKSPLYFIPAKLFGEVPLEKKD
Download sequence
Identical sequences Q9WYJ6
gi|15643129|ref|NP_228172.1| 282236 243274.TM0361 gi|15643129|ref|NP_228172.1| NP_228172.1.35502 WP_010865101.1.100023 WP_010865101.1.29620 WP_010865101.1.43545 WP_010865101.1.45724 WP_010865101.1.51363 WP_010865101.1.56403 WP_010865101.1.79805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]