SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0A5S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R0A5S6
Domain Number - Region: 52-145
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0A5S6
Sequence length 160
Comment (tr|R0A5S6|R0A5S6_CLOBU) Uncharacterized protein {ECO:0000313|EMBL:ENZ31798.1} KW=Complete proteome OX=997898 OS=Clostridium butyricum 60E.3. GN=HMPREF1084_02879 OC=Clostridium.
Sequence
MPTMSPQQYMNKINEWVDAELDTVQLRLIIAELSINEIVNISQFDPEVRGGEVGDIYFSI
AFRTHKPLLIGYIDNSQSSYQGGLIDYGNRYFGDDTYSDGDKIKIVITATVYEEDSQNST
GLGYAYEGETYTVYKQWGDWLSIYWGSSGGYVHKGFVTKA
Download sequence
Identical sequences R0A5S6
WP_002581896.1.1134 WP_002581896.1.34338 WP_002581896.1.57752 WP_002581896.1.65800 WP_002581896.1.72530 WP_002581896.1.86677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]