SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0IVX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0IVX8
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-84
Family Capz beta-1 subunit 0.0000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R0IVX8
Sequence length 265
Comment (tr|R0IVX8|R0IVX8_SETT2) Uncharacterized protein {ECO:0000313|EMBL:EOA88945.1} KW=Complete proteome; Reference proteome OX=671987 OS=(Exserohilum turcicum). GN=SETTUDRAFT_168156 OC=Pleosporaceae; Setosphaeria.
Sequence
MADPIDSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLC
CDYNRDGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKAVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSES
LGGLDLSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDL
RSLQSLSQANKDRATQREMINSMGR
Download sequence
Identical sequences R0IVX8
XP_008023574.1.61199 jgi|Settu1|168156|fgenesh1_kg.14_#_191_#_isotig07578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]