SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0J9Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0J9Y5
Domain Number 1 Region: 107-213
Classification Level Classification E-value
Superfamily ERP29 C domain-like 6.28e-27
Family ERP29 C domain-like 0.0000223
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.75e-20
Family ERP29 N domain-like 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R0J9Y5
Sequence length 214
Comment (tr|R0J9Y5|R0J9Y5_ANAPL) Endoplasmic reticulum protein ERp29 {ECO:0000313|EMBL:EOA93781.1} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_12884 OC=Anatinae; Anas.
Sequence
KVIPKHKFVLVKFDTQYPYGEKQDEFKKLAESSGSSEDLLVAEVGISDYGDKLNTDLGEK
YKMDKEKFPIFYLFRDGDFDNPLPYTGQIKAGAIQRWLKSSGIYLGMPGCLKEYDMLASK
FVSTTEKSERQSLLKKGQQSLEKAKETEKKSAEQYLKIMSKILEQGEEFAANEVVRITKL
IEKNKMSDGKKEELQKSLNILASFLKKNNEKDEL
Download sequence
Identical sequences R0J9Y5
ENSAPLP00000008196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]