SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0LRT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0LRT2
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.1e-81
Family Capz alpha-1 subunit 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0LRT2
Sequence length 279
Comment (tr|R0LRT2|R0LRT2_ANAPL) F-actin-capping protein subunit alpha-3 {ECO:0000313|EMBL:EOB03143.1} OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=Anapl_05573 OC=Anatinae; Anas.
Sequence
MSVKQSEPEKVSLICRLLRQSPPGEFGQVVQDLYALVKDDELVRQEAAHVGAHHNKKNFT
PVQVNGSTVLLTHYNDLGGNRFFYPQDKFSFEFDHLSGITSKTHLHSVMLDEEELWRGAL
HKGLNTYVNCHFPAGNCCVFKKSLGKRQMFVACIEAHEYQPLKHWNSLWKSDWTFALTPI
MTRVTGVFLLQLHYFKDANLHVTIRKSVSESLHVIDRNQFVSDFVKFVKTEDDKIHTAIL
QNIQALSEDMWRKDLRRKLPITRTFMNWNELLKNYHQNT
Download sequence
Identical sequences R0LRT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]