SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1BV25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R1BV25
Domain Number - Region: 27-74
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0445
Family Capz alpha-1 subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R1BV25
Sequence length 92
Comment (tr|R1BV25|R1BV25_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD13582.1, ECO:0000313|EnsemblProtists:EOD13582} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_48393 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
QQALRAALRETLDAKGVLRELRARIQAEVFSAVRDTSDPRPRLSQEKLLLNEAIREYLEF
SGYNHTLSVFLAEAGQPEEKLARQVVAGQLRL
Download sequence
Identical sequences R1BV25
XP_005766011.1.92643 XP_005788233.1.92643 jgi|Emihu1|48393|gw1.53.54.1 jgi|Emihu1|49408|gw1.1379.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]