SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1EGM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1EGM9
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000000183
Family Capz beta-1 subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R1EGM9
Sequence length 87
Comment (tr|R1EGM9|R1EGM9_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD25860.1, ECO:0000313|EnsemblProtists:EOD25860} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_206056 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MNLSGSLTRQKEEELAVGDVASHVANMGRMVEEMESRMRDTPTKSVVNGLYQSGGAEANK
KKDMLAQASGPAPPPALMAEMGKRNAD
Download sequence
Identical sequences R1EGM9
XP_005778289.1.92643 jgi|Emihu1|206056|gm1.2500326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]