SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1EIA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R1EIA9
Domain Number - Region: 813-882
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0785
Family Capz beta-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R1EIA9
Sequence length 1015
Comment (tr|R1EIA9|R1EIA9_BOTPV) Putative exocyst complex component sec5 protein {ECO:0000313|EMBL:EOD47272.1} KW=Complete proteome; Reference proteome OX=1287680 OS=(Neofusicoccum parvum). GN=UCRNP2_5989 OC=Botryosphaeriaceae; Neofusicoccum.
Sequence
MPAQMERQLLEHYNLKTLYPSEWPQEKDEAEDSDDEAQPSRQSAAIVRRRSRYSVLERSG
VRSSVLNTEKTKEGVDTLVQKDEADPLGNASSVVNVLRQRGLPVEDDLKLRNRFLLSSTT
FNPGLFLSQVHSDASTESLLQGLDFLSRSIEKKSASLKVLVESNFERFVRAKTTIDNVYM
EMRDQRSDAQPASHSRTGSRQFSGRQSGHYRRASQALIAPGQAPAGDKRKTALTKESEYG
VQGIKAPLLEVAVKAEEIWGPALGGRERGEMLKSILSSVERHRNLFEIGASIQDCIKRRD
YDILPEEYNKARRYASDAKKIVEMSVDNRTAMTDPEIHQVIVTARMWTDVEEQIAVFKRD
VWKRLAGTHFTKQAPSEDEKPEQHMTLIKVLLELGVEDNPIWVWLLSRYDFLKQKITATL
ERSKVELEILRRRLGNGEKPTPRQIATYLRAAEHLEKPNHSTKMDSTKIIDFWDHELQSL
NAILSPQGGVLGEVIEYWETAQSFIDGKAQRTLPVGPEGQSKAHHRLSSSGVMDLQGGAK
ELVNLIREGVQSFFTEAPIDDISLLYSPIPDTPATPRTPMPGPLTPSMDSRFKIDSSNPP
PSPRTGAGWEKYAFWAPYANSLSGVHYLSKILVLVGSAASEIAAMRITRDGTRSSEELKL
FVGTIRERCVQSVCAAWGEDADYAKLLEDWTRWSDNKYLTNMPFRFVALDNSLLAIMQKM
LYLSEAMTRSSAGEVVVPPSSKLLAMVKSQFVTSIYKVLQGMVENVERPKNLDNSGWEDD
VDGLTLPLRTLTTRDISSNAVDATDKNIRILLTLSNLQALRTDLIPQLISQYEQHFSVKL
EEGAKIDDALSQIYARLFQSYTSPISTKLAAIIREGIAAPGWEPDTNRPADARAYVYDVL
LELVVVHTQVSTTAAPLTSQILKYLLEQVSKHLIENFKARPRYTLAALMQATLDVEFLAQ
TLGNYTTDKASEIQSAIYLALDERTDNDARVKLQTELGGLRVILKKLREATKSEL
Download sequence
Identical sequences R1EIA9
XP_007585250.1.99346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]