SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R1FPB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R1FPB9
Domain Number 1 Region: 6-208
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.32e-50
Family Capz beta-1 subunit 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R1FPB9
Sequence length 210
Comment (tr|R1FPB9|R1FPB9_EMIHU) Uncharacterized protein {ECO:0000313|EMBL:EOD35254.1, ECO:0000313|EnsemblProtists:EOD35254} KW=Complete proteome; Reference proteome OX=2903 OS=Emiliania huxleyi (Pontosphaera huxleyi). GN=EMIHUDRAFT_44624 OC=Eukaryota; Haptophyceae; Isochrysidales; Noelaerhabdaceae; Emiliania.
Sequence
MADPQLLAALDLMRRMPPSRCETSLEELVDLVPHLTDDLLNTIDQPLQTAKDAQGNAYLL
CDYNRDGDSYRSPWTNEYDPPLSDGVLPSPKLRAMETLANDIFEGYREMYYEGGISSVYF
WDLDEEGAFSKWSPPGSQRHGGGGGGALAVLLSGGVAAAAAQVGVHEGEMNLSGSLTRQK
EEELAVGDVASHVANMGRMVEEMESRMRDT
Download sequence
Identical sequences R1FPB9
jgi|Emihu1|44624|gw1.140.11.1 XP_005787683.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]