SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R2PR83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R2PR83
Domain Number - Region: 444-565
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz beta-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R2PR83
Sequence length 677
Comment (tr|R2PR83|R2PR83_9ENTE) Uncharacterized protein {ECO:0000313|EMBL:EOH85818.1} KW=Complete proteome; Reference proteome OX=1158604 OS=Enterococcus villorum ATCC 700913. GN=UAO_02712 OC=Enterococcus.
Sequence
MTNKFLKYFLCFLFILVTIAISFSKINQQNLNKTVHTFNHTTNYSPLRVPKIFVQESEYR
QLISLFETLSLKNDIPYMKKVTNESNEIKEGFNFKIRPKLEITFYYQNQKEPTNFKLPFS
NTRFLIENIQQSITKKEFEGEFFLLTSDKEKYEIYAKGFAKGYNKIFQTTYEVDVFSDFN
NELNYSPISSTDLYHFSSYVQIGILFFVFALGSYYFILIKEIHLLSNYGFSVKHIMHTLI
GKTTMFFLLCVVSIESFLMWKMFREQFLPYTFLLTLLLGGSYFISLIFIYLIIKLPSMKK
RLKYLQFLTFTVTLLFSFILAITSTNLSEIILATTNLWNTYEVPSEIVSENYEVFYPLTI
GKNHIEFIYANQLQKHMDDSLYESLNEQGSILVNLSDYHIKENEIFGRGIKVNPNYLKKF
QILDEKGERIYIDEQEQKHILLIPERYKEKDLRNELEEVISYYNDFYQQKTKVYYIQDNQ
SIYTFTLHDPWIDDYPFIEILTLKNSTFWERNIINGDSSPPLKVKADPTNRKKILKLVEK
NQLSDNLQLLFPYTKAEEIVVKMISKSLGQLISIFIVTMISFISLSFLVLSILFIYNKRT
IALLRLSGFSLLSTYRTLFIQIFFKWGLATIFMFIFWESDLKIIINMIIFIMIDLSMTIV
FLLYIEKKNNLFILSGW
Download sequence
Identical sequences R2PR83
WP_010752541.1.68004 WP_010752541.1.86333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]