SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4NZN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4NZN9
Domain Number 1 Region: 6-154
Classification Level Classification E-value
Superfamily Hypothetical protein TM0875 3.14e-95
Family Hypothetical protein TM0875 0.0000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4NZN9
Sequence length 158
Comment (tr|R4NZN9|R4NZN9_THEMA) Uncharacterized protein {ECO:0000313|EMBL:AGL49802.1} KW=Complete proteome OX=243274 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099). GN=Tmari_0877 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MRLMDILEILYYKKGKEFGILEKKMKEIFNETGVSLEPVNSELIGRIFLKISVLEEGEEV
PSFAIKALTPKENAVDLPLGDWTDLKNVFVEEIDYLDSYGDMKILSEKNWYKIYVPYSSV
KKKNRNELVEEFMKYFFESKGWNPGEYTFSVQEIDNLF
Download sequence
Identical sequences Q9WZX8 R4NZN9
gi|15643637|ref|NP_228683.1| gi|15643637|ref|NP_228683.1| 282744 APC4447 NP_228683.1.35502 WP_004080723.1.29620 WP_004080723.1.45724 WP_004080723.1.51363 WP_004080723.1.56403 WP_004080723.1.79805 243274.TM0875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]