SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4S1F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4S1F0
Domain Number 1 Region: 117-213
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000085
Family Intein endonuclease 0.056
Further Details:      
 
Weak hits

Sequence:  R4S1F0
Domain Number - Region: 203-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz alpha-1 subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4S1F0
Sequence length 319
Comment (tr|R4S1F0|R4S1F0_PHYAS) Putative sporulation transcription regulator WhiA {ECO:0000256|SAAS:SAAS00981672} KW=Complete proteome OX=980422 OS=Strawberry lethal yellows phytoplasma (CPA) str. NZSb11. GN=SLY_0678 OC=Acholeplasmataceae; Candidatus Phytoplasma; 16SrXII (Stolbur group).
Sequence
MSFTIQIKEEIALQKLSPLENFFELTALLHFGAELEKNNKKTLLWFKTKNLKIARRFLIL
IKSFYDVNSLLMTSKEYNLPHLKSIYIGIEKEIPLILGQHHFLLNNQKDFFQELKRSLKK
KKAYLRGAFLCIGYVSNPEKNNNHLELFHQDASKINLIKELMLGFGLNAKQIAHKKGFLV
YLKESQMIIDFLRLIGAFETVFQYEKNNIQKDFNKIIKKTINFELSNEKKIINNANKQLQ
SINLFEKNQIQGDFSDKNKKMFQIIELRKKYPDASLKELTQKYCKKYQKKITKSGINYYF
QKIKEINEKSESSFKKKIK
Download sequence
Identical sequences B1VAY2 R4S1F0
gi|197294789|ref|YP_001799330.1| gi|501676545|ref|YP_007996872.1| WP_012359215.1.17149 WP_012359215.1.56962 59748.PAa_0771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]