SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4THQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4THQ7
Domain Number 1 Region: 1-298,396-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-23
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  R4THQ7
Domain Number - Region: 295-395
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0188
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4THQ7
Sequence length 462
Comment (tr|R4THQ7|R4THQ7_9PHYC) Amino-oxidase family protein {ECO:0000313|EMBL:AGM15438.1} KW=Complete proteome; Reference proteome OX=251749 OS=Phaeocystis globosa virus. GN=PGCG_00126 OC=unclassified Prymnesiovirus.
Sequence
MKNYDIIIIGGGISGIYTMYNLKKKYPTLKVLLLEKDDRFGGRIYTYFEKINNQTYKMDL
GAGRLGFHHKRIMNLLEDLKLKNEIIPITNTENYIEYDKKTNIATDKSAEKRGIVDLLYK
FFNSSKISNLTHKFLKKLNLMELFSKFFTREMCKTIENSFEYKCKLKYFNADDAVYYFKH
DYNKYSKFFVLKNGLQGLIDGMLNKIKTNKNYVFKKNQNVKKINYDMERNLYNINYNSKN
SSHSVYSKFVICALPRKDLIKFDILSPYMSDLNTINEIAKMRIFEIYDTKTTEAWFKDLP
KISTNEELQFVIPIDPKSGLIMSSYNENLSTYESYWLNLYNKSKREFKSTLNEKLNNIFG
VFDVIVPKSIYVKLHYWSMGVAAWKKNVDSKYISHKIINLMPNFYICGENYSNYQAWCEG
ALQTSEEVGNRISCILDNLKRNKTKKVLKKQKKYNLYLTATH
Download sequence
Identical sequences G8DHL5 R4THQ7
YP_008052445.1.98695 gi|508181926|ref|YP_008052445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]