SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4WED2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4WED2
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-89
Family Capz alpha-1 subunit 0.000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4WED2
Sequence length 259
Comment (tr|R4WED2|R4WED2_RIPPE) F-actin capping protein alpha {ECO:0000313|EMBL:BAN21623.1} OX=329032 OS=Riptortus pedestris (Bean bug). GN= OC=Panheteroptera; Pentatomomorpha; Coreoidea; Alydidae; Riptortus.
Sequence
EFNEVFNDARILLSNDTLLKEGALGVFGQYCKDQLTPVKIKNGDHPVLITEHNDLGSNRF
YDGRTKQSFKYDPLRRETSNYDTWEPEPGTEKWRAALETELDLYISKHFESGAGSVFSKK
EDGKVCLVACIEAHLFQPKNCWNGCWRSQWFVTIDSENADVKGVLKIQVHYYEDGNVQLV
TSKEINQSLQVSDEEQLGKDLIKLFEESETEYQKAISENYHTMSDTTFKALRRQLPVTRT
KIDWNKMVSYTIGKELKPQ
Download sequence
Identical sequences R4WED2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]