SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4ZDY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R4ZDY8
Domain Number - Region: 204-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0243
Family Capz alpha-1 subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4ZDY8
Sequence length 271
Comment (tr|R4ZDY8|R4ZDY8_CBEPV) Uncharacterized protein {ECO:0000313|EMBL:CCU55842.1} KW=Complete proteome; Reference proteome OX=10288 OS=Choristoneura biennis entomopoxvirus (CbEPV). GN=CHBEV_274 OC=Betaentomopoxvirus. OH=7141
Sequence
MFFFYKIILFILNILYNFIIFDIIDFCVLIILHLYQKILYLDRIFEIIYYKITNTAKMIN
FKYIYSNIIYYINIYFIQYIYINIIFPFKKYIFLNQNIEILELLFNDEMNTFYLNMYKLF
KNNNFINVINKLKEILYMMRDIINIESINNIFSTISDELEENCPDKINFILNHRLMPNLI
DEITKILNFSNLDNSNNINDIIISFIDDVKNIINNDDDIKNVLYEFFKIYNNNNKTVQCL
RNYIDNGIISKIVFVISKNILNLYLKMRVYR
Download sequence
Identical sequences R4ZDY8
YP_008004344.1.61769 gi|506498548|ref|YP_008004344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]