SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R4ZE98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R4ZE98
Domain Number - Region: 147-195
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz alpha-1 subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R4ZE98
Sequence length 225
Comment (tr|R4ZE98|R4ZE98_9POXV) Uncharacterized protein {ECO:0000313|EMBL:CCU56142.1} KW=Complete proteome OX=1293539 OS=Choristoneura rosaceana entomopoxvirus 'L'. GN=CHREV_240 OC=Betaentomopoxvirus.
Sequence
MINFKYIYTNIIYYINIYFIQYIYINIIFPFKKYIFLNQNVEILELLFNDEMNTFYVNIY
KLFKNNNFINVINKLKEILDMKRDIINIESINNIFSTISNELDENYPDKINFILNHRLMP
NLIDEIKNILNLSNLDNSNNINDIIISLIDDVINIINNDDDTKNVLYEFFKIYNNDNKTI
ECLRNYIDNEIISEIVFVIIKNLLNLYLKMRVDNININNTSVANI
Download sequence
Identical sequences R4ZE98
gi|506498850|ref|YP_008004644.1| YP_008004644.1.83847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]