SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5GAN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5GAN7
Domain Number 1 Region: 38-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-30
Family G proteins 0.025
Further Details:      
 
Weak hits

Sequence:  R5GAN7
Domain Number - Region: 375-438
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5GAN7
Sequence length 765
Comment (tr|R5GAN7|R5GAN7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCY14218.1} KW=Complete proteome OX=1262879 OS=Eubacterium sp. CAG:146. GN=BN498_02068 OC=Eubacterium; environmental samples.
Sequence
MGNNSEIIRKSYIEKKEKILALLKKTELFYADNEDEGKVEVFQSLQKNLEDGEFSIVVVG
EFSAGKSTLLNALMGQKILPSFSGETTATVNFLRHKDRATQGERGKIYYKDGQTRELQDI
SLDIINKYVSTKGDDVAKTIEHLDLYLDSKFLEDGVTLVDSPGLNGIAEGHKEITEQQIL
KSNASIFVFNSDHPGSKTDFEFLYELQKKVKTIIFVLNKIDTIKEEEGNTVEVVVDSLKK
NYKKQFPEAETIPEIWPVAAFPALMARSGEGEGQEYDPRLQPFEERLLKFLTCGEKAHQQ
LVSPIERVLSVVKESKDIYEEDIEALNNKQDSVELENKIDELQEVIKGLVDEEKENKRDI
SRKVKAAFKNLNEGLIEEIEKEQEKKLRKIDRYDELEEIVRYLKSFEEEFLRSVKRIISS
KEDDLQDHIRTIIEINYNEVAEAINERLMQSDAGINIDIKNHLDINVDAESYKVGLKEMG
EKSRKLEQELRELEEKADEAEEDFIKARDNEKRKKELQEQLIALEKTQDTINRRIMPEVD
RWEVTQADTEERGGILGGFLDIVIGEKKVNRQVMKEDRSNRDRAEKQREEELAKNKREIK
KTEEMLAGYNEDSVDLKQKRFEKMKKQIAKKMEELEKNTKNDIEKIDASYKKQIQDCKYA
LRDFCDDVTDELKSIIKKETRKEQEVYVNIVMGVVEANLQNEIKQKEDRIRNLQKQMESS
ENDKKQQLEKLNEKILVMNDILSEGIDIQAELESEEIDTIAQQDL
Download sequence
Identical sequences R5GAN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]