SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5IYR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5IYR3
Domain Number - Region: 233-341
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0162
Family Capz beta-1 subunit 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5IYR3
Sequence length 497
Comment (tr|R5IYR3|R5IYR3_9FIRM) Type II secretion system F domain protein {ECO:0000313|EMBL:CCY47205.1} KW=Complete proteome; Reference proteome OX=1263032 OS=Firmicutes bacterium CAG:822. GN=BN793_00185 OC=Bacteria; Firmicutes; environmental samples.
Sequence
MNGKFDIESIEKPTNQDITVVFSPSNNVTSYTYQIYKDNIPLNTIHVDNNSEASIDMKET
GIYKINLQLNLNDGSTDTITSGEYIIDKEAPKINISSNSLETTPTRDKDIINCTAIDNYN
GSLTEQITSNINDLTLNKVGNYTYTCSVQDEAGNVTSESANITVTPHNTSIFIIQAICLI
VIFALIIRIIKLFRVVKLEERLDPYVIKPLQNDALSTSEKLRRIYKQFLNMFTSKLKKLV
VATKYAKKLDKYAPVSGVHQSGFDILSGKIIIACALTVMAITIKVFQFKLLGSMETLVVF
VLGFFVLDIYLFAKYKVFRWNLESDFTAAITIMNNSFKSGRSISQAIDIVSTEVGGVIGS
EFKRMSLELLYGLDIEQVFKRFAKRVELEEANYLTASLTILNKTGGDIIKVFSSIERSLF
DKRKLRLELKSLTSGSRIIVYILLGIPFFFILIISFISPGYFLPFITTDIGRILLLFMII
YYIIFVVVVRKIMKVVI
Download sequence
Identical sequences R5IYR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]