SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5KRM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5KRM7
Domain Number - Region: 29-61
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0968
Family Capz alpha-1 subunit 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R5KRM7
Sequence length 99
Comment (tr|R5KRM7|R5KRM7_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CCY67724.1} KW=Complete proteome; Reference proteome OX=1262831 OS=Clostridium sp. CAG:678. GN=BN753_01353 OC=Clostridium; environmental samples.
Sequence
MKNFIEEFYYGNIEPQARSTKQNKAVQKQMEILMTNEDFLTTTLSDENKKRFLDYVNAWS
IFNGESNLDSFIMGFRLGAKFMLDTFVTSETPFEDLLRE
Download sequence
Identical sequences R5KRM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]