SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5QG39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5QG39
Domain Number 1 Region: 149-280
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-16
Family HD domain 0.03
Further Details:      
 
Weak hits

Sequence:  R5QG39
Domain Number - Region: 34-91
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00326
Family Single strand DNA-binding domain, SSB 0.035
Further Details:      
 
Domain Number - Region: 108-146
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5QG39
Sequence length 314
Comment (tr|R5QG39|R5QG39_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCZ27660.1} KW=Complete proteome; Reference proteome OX=1263008 OS=Firmicutes bacterium CAG:194. GN=BN526_00112 OC=Bacteria; Firmicutes; environmental samples.
Sequence
MKFIQDYKEGDRVSDIYLCKHKQLATTKNGKPYETAVLQDKTGTIDAKIWDPNSMGIGDY
DALDYIEVYGEVTSFQGANQINVKRLRRCQEGEYDPANYLPVSKKDIDQMMHELTKLIDS
IENTYLKALLQSFFVDDEDFVKAFRNSSAAKTVHHGFVGGLLEHTLSVTKLCDYYCGAYP
MLKRDLLLTAAMLHDIGKVKELSSFPENDYTDIGNLLGHIVMGCEMTGEKAARIDGFPID
LLNELKHCILAHHGELEYGSPKKPALMEAVALNFADNTDAKLETFTELLESTSETGWLGY
NRLLETNVRATKLL
Download sequence
Identical sequences R5QG39

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]