SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5S639 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5S639
Domain Number - Region: 12-69
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz beta-1 subunit 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5S639
Sequence length 295
Comment (tr|R5S639|R5S639_9BACE) Uncharacterized protein {ECO:0000313|EMBL:CCZ49010.1} KW=Complete proteome OX=1262746 OS=Bacteroides sp. CAG:661. GN=BN750_00881 OC=Bacteroides; environmental samples.
Sequence
MPKQKINGNFMSLQESHPLWEALETQPFWWSNILNDPELYVEVRKDNYINVYYYGGCVAL
IYWTKDGLMAETNRKYANDNFGAKALSNTSCYCNCQALFQSPENLDAIKRRIAEVYHKQP
MQAETDSLKGVHISSEKMVQGKLILHSPYKFIDSELAYQTQGRKTMRIDLIELRNQMLVF
VELKLITDSRLRHINDTPEIMEQMKKYHDFIHQDNHLEALKRYYHKILQIKRRIGIWEGK
NTIESISTRPELLIIDTYSRMTKNRQTRIANIRKSLETGGSFFDFSIQKYQDLCK
Download sequence
Identical sequences R5S639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]