SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5TUS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5TUS0
Domain Number - Region: 12-122
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.064
Further Details:      
 
Domain Number - Region: 65-99
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0948
Family Heme-dependent catalases 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R5TUS0
Sequence length 129
Comment (tr|R5TUS0|R5TUS0_9BACE) AAA-ATPase {ECO:0000313|EMBL:CCZ69495.1} KW=Complete proteome; Reference proteome OX=1262747 OS=Bacteroides sp. CAG:702. GN=BN759_01683 OC=Bacteroides; environmental samples.
Sequence
MIYQSGYLTIKGYDRDFGTFLLDFPNNEVKKGFVALIASSGYFTIKDYKPRRGTFLLDFP
NNEVKKGFVSLVASDYFKPQRENVNSWIQDLIDALEEGDTDKLHKLFTSFLADIPYTMRR
KQDERERER
Download sequence
Identical sequences R5TUS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]