SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R5UME4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5UME4
Domain Number - Region: 5-133
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0246
Family Capz beta-1 subunit 0.095
Further Details:      
 
Domain Number - Region: 158-201
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.0567
Family Cytochrome c oxidase subunit I-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R5UME4
Sequence length 248
Comment (tr|R5UME4|R5UME4_9BACE) Lipoprotein {ECO:0000313|EMBL:CCZ69907.1} KW=Complete proteome; Reference proteome OX=1262747 OS=Bacteroides sp. CAG:702. GN=BN759_02064 OC=Bacteroides; environmental samples.
Sequence
MKNLFFNLIILLSASVCVTSCSNDEVINVKSPVMRDYQTDSQILSKFVDFNSSTGEYFIN
ESKRPNAVSYLNDKDWLELQKVNPINYDRYEKELKELNKQLTEYVNNPNISKIIYTTYGG
KTYVKDLNNNSSIQIEKSSISSRNTNPNYSQMNISGGAQSYASFNAGSTIHTNIQILGLG
YYLYELKCNTKGAYYNNNHPSSIVLSGTGPTGTASYTWTSGSTSTFWDFIGMDKTSQFGQ
IARIDFVD
Download sequence
Identical sequences R5UME4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]