SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5YX15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5YX15
Domain Number - Region: 74-147
Classification Level Classification E-value
Superfamily Ferritin-like 0.00264
Family Ferritin 0.023
Further Details:      
 
Domain Number - Region: 35-60
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0379
Family RILP dimerisation region 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R5YX15
Sequence length 196
Comment (tr|R5YX15|R5YX15_9FIRM) DivIVA domain-containing protein {ECO:0000313|EMBL:CDA31395.1} KW=Complete proteome OX=1262984 OS=Lachnospiraceae bacterium CAG:25. GN=BN562_00998 OC=environmental samples.
Sequence
MITPVEVLGKELRRGFGYKAVEVDEFLEELAKDYEKVYKENNELREKVSALTENLSHYRT
IEESLKRALVLAEETSKETIENANNKAQALEAEASRNAKQLVSEAEDQAEKILTSAKEDF
KEEKEQHEKTIENYQKLIRKLESDYQSYKARMKQFINGQMDILDNPVYEMEFEIAGCEQT
DGDEEDEQQKQFGNEQ
Download sequence
Identical sequences B0NWL4 D4MYU2 E5VL91 R5YX15
WP_008391543.1.33200 WP_008391543.1.34949 WP_008391543.1.38793 WP_008391543.1.48195 WP_008391543.1.5280 WP_008391543.1.72650 WP_008391543.1.96038 gi|479159513|ref|YP_007788782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]