SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6BRB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6BRB9
Domain Number - Region: 136-211
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0471
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.032
Further Details:      
 
Domain Number - Region: 59-143
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.068
Family Capz alpha-1 subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6BRB9
Sequence length 261
Comment (tr|R6BRB9|R6BRB9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CDA66663.1} KW=Complete proteome; Reference proteome OX=1263102 OS=Prevotella copri CAG:164. GN=BN510_02042 OC=Prevotella; environmental samples.
Sequence
MKKFIYLMAMVCTLGFFTACSSDDDDNDKDYFVRNEKIEGTWGLQEVEKIELGGGKGEFY
NGSVKITWDCPADTKLNIDFGGGLVMPMDVKEQILPLMNNMANEYLPQILKNVTFTKDGK
INATYSELPDEGETSDWKTADGYASYSVANDNLIYVTIDANKATEDIDDAAEKAQIQGIL
QQYNKIPVNIRWNGTKPYFFVDKAFVQPMLANLVAMLEKVPATDMDADDLQSFNMLKGIM
VQLPEIMNKTTTFELGLELIK
Download sequence
Identical sequences R6BRB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]