SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6NAJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6NAJ9
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily CPE0013-like 1.83e-24
Family CPE0013-like 0.0019
Further Details:      
 
Weak hits

Sequence:  R6NAJ9
Domain Number - Region: 6-40
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00366
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6NAJ9
Sequence length 121
Comment (tr|R6NAJ9|R6NAJ9_9CLOT) Uncharacterized protein with conserved CXXC pairs {ECO:0000313|EMBL:CDC09053.1} KW=Complete proteome; Reference proteome OX=1262803 OS=Clostridium sp. CAG:413. GN=BN649_01260 OC=Clostridium; environmental samples.
Sequence
MQKNIICVACPMGCGITVELSDSGEILSVTGNTCKRGDAYARSECTNPVRSLATTVKVDG
GIHNVVPCKSAGPLPKGMIMDCMKTVNATEVKAPVKLGDILIENICGTGVNIVATNHCPC
K
Download sequence
Identical sequences R6NAJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]