SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6PBQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6PBQ5
Domain Number - Region: 63-97
Classification Level Classification E-value
Superfamily Synuclein 0.0798
Family Synuclein 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6PBQ5
Sequence length 159
Comment (tr|R6PBQ5|R6PBQ5_9BIFI) Cell division protein SepF {ECO:0000256|HAMAP-Rule:MF_01197} KW=Complete proteome OX=1263060 OS=Bifidobacterium pseudocatenulatum CAG:263. GN=BN571_00244 OC=Bifidobacterium; environmental samples.
Sequence
MAGFMKSAMSYLGMTDVAEGDEDFNEEAESSETSFDSDHSVTPMASTPAATSAPREQTKA
NPFQGGRVSRITTIHPKSYEDAQLVGRAIRDGVPVVLNLTGVAEAVAYRIVDFSAGVVFG
VRGSIERVTPRVFLLSPAQVNIKVEEPQANNSSHDLFAD
Download sequence
Identical sequences A0A072MT60 A0A139B823 C0BSD6 R6PBQ5
WP_004220690.1.100601 WP_004220690.1.10796 WP_004220690.1.12562 WP_004220690.1.14184 WP_004220690.1.26643 WP_004220690.1.28806 WP_004220690.1.39608 WP_004220690.1.44110 WP_004220690.1.4717 WP_004220690.1.80334 WP_004220690.1.82414 WP_004220690.1.85003 WP_004220690.1.8838 WP_004220690.1.93585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]