SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R6PEZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6PEZ2
Domain Number 1 Region: 144-280
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000000262
Family HD domain 0.022
Further Details:      
 
Weak hits

Sequence:  R6PEZ2
Domain Number - Region: 78-144
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6PEZ2
Sequence length 314
Comment (tr|R6PEZ2|R6PEZ2_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDC22908.1} KW=Complete proteome; Reference proteome OX=1263069 OS=Clostridium nexile CAG:348. GN=BN618_00683 OC=Clostridium; environmental samples.
Sequence
MRFINTLHEGETIRGIYLCKTKRTAETRNGKPYDNLLLQDKTGTLDGKIWDPNSGGIADY
DEMDFVEVLGEVISYNNNLQLNIKQLRKPYEDEYNPADYMPTTEKSVDGMYEELLSYIGK
VENTYLHQLLEYYFVKDEAFIKRFKNHSAAKSVHHGFAGGLLEHTLSILKMCEYYVSAYE
ILNKDLLYTAAIFHDIGKTKELSTFPENDYTDDGQLLGHIVIGVEMIGEGVRTIEGFPEK
LASELKHCVIAHHGELEYGSPKKPALAEAVALHYADATDAKLQTLTEIFKEKEGNKDWLG
YNRLFESNLRRSSI
Download sequence
Identical sequences B6FP32 R6PEZ2
WP_004612808.1.82493 WP_004612808.1.93157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]