SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6PG53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6PG53
Domain Number 1 Region: 47-119
Classification Level Classification E-value
Superfamily CPE0013-like 1.14e-25
Family CPE0013-like 0.0021
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.000001
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R6PG53
Sequence length 121
Comment (tr|R6PG53|R6PG53_9FIRM) Zinc finger protein {ECO:0000313|EMBL:CDC08752.1} KW=Complete proteome; Reference proteome OX=1262983 OS=Lachnospiraceae bacterium CAG:364. GN=BN627_02265 OC=environmental samples.
Sequence
MNVRELTCINCPLGCSLTVTLDGEKVIKVEGNTCPKGKTYGEKEAINPTRILTSSVMVTD
GKLPVVSVKTASDIPKNKIRECAAGLKNITVQAPVKIGDIILENIGGTGVALIATKNVEH
R
Download sequence
Identical sequences R6PG53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]