SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6WH25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6WH25
Domain Number 1 Region: 19-90
Classification Level Classification E-value
Superfamily CPE0013-like 3.79e-25
Family CPE0013-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6WH25
Sequence length 92
Comment (tr|R6WH25|R6WH25_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDD03461.1} KW=Complete proteome OX=1262845 OS=Clostridium sp. CAG:91. GN=BN808_00586 OC=Clostridium; environmental samples.
Sequence
MTGNRCPRGAAYGEKEVTNPTRIVTSTVRVEGYPDTVVSVKTASDIPKGRIDDCMKALAD
VTAAAPIHVGDVIVENVADTGVNIVATRSFRG
Download sequence
Identical sequences R6WH25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]