SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6WI79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6WI79
Domain Number 1 Region: 41-112
Classification Level Classification E-value
Superfamily CPE0013-like 9.15e-20
Family CPE0013-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6WI79
Sequence length 120
Comment (tr|R6WI79|R6WI79_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDD09105.1} KW=Complete proteome; Reference proteome OX=1262797 OS=Clostridium sp. CAG:349. GN=BN619_01243 OC=Clostridium; environmental samples.
Sequence
MKELVCIVCPNSCKLSISENGEVTGARCPRGKKFATEELTCPKRTVCTTVATVFDDYPVL
PVRTETEIPKDKIPALMELVNNFTLKKRVARGEVVIENVLDTGVNLISTSNMLYDYFVKI
Download sequence
Identical sequences R6WI79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]