SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7FAC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7FAC6
Domain Number - Region: 36-89
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0209
Family Cytochrome c oxidase subunit E 0.0076
Further Details:      
 
Domain Number - Region: 79-127
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7FAC6
Sequence length 143
Comment (tr|R7FAC6|R7FAC6_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDE12249.1} KW=Complete proteome; Reference proteome OX=1262954 OS=Ruminococcus sp. CAG:330. GN=BN611_01519 OC=Ruminococcus; environmental samples.
Sequence
MMETRKSGDFLSHGMWLKSVVTEDVILCGVSALEYMGLFTGYLNERVIDVYARKKGIYQN
INYNLVPDFHEIEYFTQNGLRCTTFTQTVNDMLHQIEEADDAALTEALATYYFAHDESFQ
GLRILPENKTAFMELASMAMVYY
Download sequence
Identical sequences R7FAC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]