SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7K419 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7K419
Domain Number - Region: 46-153
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.012
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7K419
Sequence length 194
Comment (tr|R7K419|R7K419_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDE70626.1} KW=Complete proteome; Reference proteome OX=1262970 OS=Subdoligranulum sp. CAG:314. GN=BN603_00008 OC=Subdoligranulum; environmental samples.
Sequence
MYKKKIKARSIVAVALLLLLCMCFLCGCIHTPPDETENLEYNIRLSGFYELENYSDCYTK
EEYIMSFSQLKWYCSKVNSSAFDETDEENYNSEFNQVLRTYDDEYFEEKALIIAIHTGNL
EFLGAEITAVKKEKEYFLAIEMTVTYWGGGTIAMVVPDKHWVFLIEIDKVGIVFDEYTRY
EYIVEYEDDQKFLS
Download sequence
Identical sequences R7K419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]