SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7KD23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7KD23
Domain Number - Region: 19-114
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0811
Family Capz beta-1 subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7KD23
Sequence length 145
Comment (tr|R7KD23|R7KD23_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDE73721.1} KW=Complete proteome; Reference proteome OX=1262809 OS=Clostridium sp. CAG:451. GN=BN663_00613 OC=Clostridium; environmental samples.
Sequence
MNQQYQYRPNFNYQRNSSNYLRQVSDDNNLYSSSEGFTLGNMFKDSYIPYKNYTPQVLTP
TSEQDDLFLRLSEQEFAAHDLNLYLDLNPQDGNMLEIFNQYRKEANNLLNEYEARYGVIN
ISSEALKDSPFKWEMENFPWNEGGM
Download sequence
Identical sequences R7KD23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]