SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7R3D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7R3D8
Domain Number - Region: 14-52
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0373
Family VPS23 C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7R3D8
Sequence length 113
Comment (tr|R7R3D8|R7R3D8_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDF44220.1} KW=Complete proteome; Reference proteome OX=1262940 OS=Roseburia sp. CAG:100. GN=BN450_00914 OC=Roseburia; environmental samples.
Sequence
MQRLERFPAEKINLYEQFRSGMVKQDVFLKEKEQLSRQEEVVRRQIEKVSEQIDMQEERE
KNYRCVADLVKRYGTSETLTEEFMREMVEKVIVYEDKRIEIVWKYREEFEELL
Download sequence
Identical sequences R7R3D8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]