SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7SB52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7SB52
Domain Number - Region: 37-69
Classification Level Classification E-value
Superfamily An insect antifreeze protein 0.0693
Family An insect antifreeze protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7SB52
Sequence length 331
Comment (tr|R7SB52|R7SB52_TREMS) Uncharacterized protein {ECO:0000313|EMBL:EIW65422.1} KW=Complete proteome; Reference proteome OX=578456 OS=9311 / NRRL Y-6157 / RJB 2259-6) (Jelly fungus). GN=TREMEDRAFT_66599 OC=Tremellomycetes; Tremellales; Tremellaceae; Tremella.
Sequence
MGQRLIPFETVSEWAKGSFLFRQSQNGPLKSPENSSDSPEIPQSRVVTRTCAYSNFNSTW
ITKSIRIDTAERTGLIPFGTVSEWAKVGLIPFETVSEWAKVGLIPFETVSEWTKGSFLLR
QSQNGPKTGTAERTGLIPFETVSEWAKVGLIPFETVSEWAKGSFLLRQSQNGPKVDSFSD
SLRMPLKSPENSSDSPEIPQSRVVTRTCAYSNFNRLIPFGTVSEWAKGSFLLRQSQNGPK
VDSFSDSLRMPVKSPENSSDSPEIPWARAGSFLLRQSQNGPNAEFPQSQVVTRTWAYSNF
NSTWITKSIRIDAAERTGLIPFETVSEWAKG
Download sequence
Identical sequences R7SB52
XP_007008688.1.33187 jgi|Treme1|66599|fgeneshTM_pg.34_#_1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]