SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7SQ36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7SQ36
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-78
Family Capz alpha-1 subunit 0.0000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7SQ36
Sequence length 296
Comment (tr|R7SQ36|R7SQ36_DICSQ) F-actin capping protein alpha subunit {ECO:0000313|EMBL:EJF57092.1} KW=Complete proteome; Reference proteome OX=732165 OS=Dichomitus squalens (strain LYAD-421) (Western red white-rot fungus). GN=DICSQDRAFT_38851 OC=Agaricomycetes; Polyporales; Polyporaceae; Dichomitus.
Sequence
MDPAERIEAASKFLLQSPPGEINDVLNDVRNIISDDDSLQSGVLPALREYNITQFTTAEV
PGHQHQSIVSSAARIPGAEEDEDGELSQDRYWDPRSRTSFRFDHLSLESSDPEPYEPDAE
SEPFRAALENASLQYLQAHYHDGVASVFPVAGSSTRFVIQIVANKYNPNNYWSGRWRSEY
TIDTSTKTLEGRILVNVHYYEQGNVQLSTTHTVSLALPPAIAPSGGASAASKVLALVEAE
EGKYQTSLNEAYAEMGEKTFKGLRRALPMTRSKLDWDRVLGYKLGAELTNSKGVFG
Download sequence
Identical sequences R7SQ36
XP_007370144.1.3125 jgi|Dicsq1|38851|gw1.61.121.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]