SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7TF31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7TF31
Domain Number 1 Region: 8-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-98
Family Capz alpha-1 subunit 0.0000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7TF31
Sequence length 292
Comment (tr|R7TF31|R7TF31_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELT90161.1, ECO:0000313|EnsemblMetazoa:CapteP163423} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_163423 OC=Capitellida; Capitellidae; Capitella.
Sequence
MADSEGVLSDQEKGRIASDFLLHAPPGEFNEVFNDVRILINDDNFLRQHAAAAFAKYNMD
QFTPCHLDGNDKPTIITEHGMVEKGGSQFLDPRTKQCFKYDHLRKEASEPRPMETDNVSE
PWRKALETALTSYGSEHYCTGVTAVYGSSADGFITLTACLESHKFSPQNFWNGRWRSQWK
VVFPESGGTADIEGLFKLQVHYYEDGNVQLVSSKDIKESMKVTNANDLARDVLRFITDSE
NTYQGAISENYTSMSETTFKALRRILPLTRTKVDWNKILGYSIGSELKNART
Download sequence
Identical sequences R7TF31
jgi|Capca1|163423|estExt_Genewise1.C_7970007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]