SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R7Z5K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7Z5K7
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-84
Family Capz alpha-1 subunit 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7Z5K7
Sequence length 269
Comment (tr|R7Z5K7|R7Z5K7_CONA1) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EON69299.1} KW=Complete proteome; Reference proteome OX=1168221 OS=yeast). GN=W97_08459 OC=Dothideomycetes; Dothideomycetes incertae sedis; Coniosporium.
Sequence
MPSNSEALASFVESAPPGELSNVTNAIKTIAGDSSLQSLGPALERYNEEQFTTVTLPGSS
QPVVVSSYNSLGDGRYFDVESQSSFAFDHNTQKASAVQSYALESKNADLIKSILKSLSTH
SNEHYPSSSLGVYPIENDGAIAILLVANKYSPNNFWNGRWRSQYTFSSGQLTGSIHVDVH
YYEDGNVRLLTDKPVSASLSSSASASEIVRQIASIERKYQEDLNKAFGSLSEGAFKGLRR
QLPITRQKIEWEKISGYRLGQDIGGGRAR
Download sequence
Identical sequences R7Z5K7
XP_007784616.1.34565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]