SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8GF26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R8GF26
Domain Number - Region: 38-114
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R8GF26
Sequence length 178
Comment (tr|R8GF26|R8GF26_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOO59111.1} KW=Complete proteome OX=1053175 OS=Bacillus cereus BAG1X2-3. GN=ICM_02593 OC=Bacillus cereus group.
Sequence
MDIFQYLEEMQEDVFSLAVEQIEAKYYDICCMLASTEYAERIKAIDLESYNESIRVGLDA
AVEMATNEEAKAIYFEYDLDNEWTSQFYICEEYVPLEEEDDDWASEWTYDVEGPGSVELA
DMYNENGFDTSEKAIGITLYLIAKTLCSFISVRSEVQSNIPICIGFHDQDPIMRTGRD
Download sequence
Identical sequences A0A243KTI5 A0A2A7ZXL8 A0A2B3LDF6 R8DX16 R8FHH8 R8FXQ9 R8GF26 R8K5Z0
WP_016080878.1.13279 WP_016080878.1.22152 WP_016080878.1.60255 WP_016080878.1.79549 WP_016080878.1.84614 WP_016080878.1.85667 WP_016080878.1.94914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]