SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8GNF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R8GNF5
Domain Number - Region: 65-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00136
Family F93-like 0.068
Further Details:      
 
Domain Number - Region: 18-70
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0201
Family Capz alpha-1 subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R8GNF5
Sequence length 114
Comment (tr|R8GNF5|R8GNF5_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOO61952.1} KW=Complete proteome OX=1053243 OS=Bacillus cereus VD196. GN=IKE_05816 OC=Bacillus cereus group.
Sequence
MSNISMSSNEIIDVLCENLNDGIWALRVLYAEGAMHKEKLWDCINQYHKEYQIENEKDYE
GKKILPSRYSLDIMTARLEGAGLISFKPFGRVRVYEVTDLGNVLIKELEKRKKS
Download sequence
Identical sequences J7VJ21 J8CYN2 R8GNF5 R8XKM7
WP_000065650.1.12553 WP_000065650.1.34537 WP_000065650.1.59384 WP_000065650.1.60153 WP_000065650.1.98053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]