SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8QC06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R8QC06
Domain Number - Region: 29-122
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000262
Family Capz beta-1 subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8QC06
Sequence length 127
Comment (tr|R8QC06|R8QC06_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOP67918.1} KW=Complete proteome OX=1053231 OS=Bacillus cereus VD118. GN=IIQ_05219 OC=Bacillus cereus group.
Sequence
MSIYYELTLLSENKQEGIYELAKMATNATNNDTVELIQLKEWEKDFLICQYPDGETAWFG
TLPHGYDLNGLTSKEYIIEQLLNEFEQELEEVYWVNLDTEDYYACCYEEYIFKTNRSIYF
FSMQVHD
Download sequence
Identical sequences R8QC06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]