SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R8YB85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R8YB85
Domain Number - Region: 24-58
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz beta-1 subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8YB85
Sequence length 93
Comment (tr|R8YB85|R8YB85_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOQ66663.1} KW=Complete proteome OX=718222 OS=Bacillus cereus TIAC219. GN=IAY_00265 OC=Bacillus cereus group.
Sequence
MTIREEGLIVKDQVLSCYLKGKRCLFVIVKILKDSSNSFLCTVQNKNGDQYVKKWFSKHE
NYKELGRPTFKEVEKDWKENRESFMYPNIKALY
Download sequence
Identical sequences A0A2B1QX66 A0A2B9DMJ4 J7WJN3 R8C5J2 R8IEF0 R8YB85
WP_000155360.1.100497 WP_000155360.1.12935 WP_000155360.1.34537 WP_000155360.1.48759 WP_000155360.1.50042 WP_000155360.1.59384 WP_000155360.1.9703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]