SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9C2H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9C2H6
Domain Number 1 Region: 175-289
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), C-terminal domain 1.1e-41
Family Fe,Mn superoxide dismutase (SOD), C-terminal domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 94-181
Classification Level Classification E-value
Superfamily Fe,Mn superoxide dismutase (SOD), N-terminal domain 4.19e-34
Family Fe,Mn superoxide dismutase (SOD), N-terminal domain 0.0000532
Further Details:      
 
Weak hits

Sequence:  R9C2H6
Domain Number - Region: 55-92
Classification Level Classification E-value
Superfamily Proteasome activator 0.00549
Family Proteasome activator 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R9C2H6
Sequence length 297
Comment (tr|R9C2H6|R9C2H6_9BACI) Superoxide dismutase {ECO:0000313|EMBL:EOR23463.1} KW=Complete proteome; Reference proteome OX=1202533 OS=Bacillus nealsonii AAU1. GN=A499_12681 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSSYNEYVRNVLIWNQELKSLLEAEAVQKEESIWKRLDKFSQLMEGVQRRPIETEELIRI
QHEAENLHEQMESYFAQRQQIGTIFMKEPNVAAGKHQLPKLPYAYDALEPYISKEIMELH
HQKHHQSYVTGLNNAEEKLKAARKNKDYALVKHWSRELAFHGSGHYLHTIFWNNMSPKGG
GEPKGILMEEINNYFGSFTAFKEHFTEAAKAVEGVGWALLVWSPRARHLEVLQSERHMLL
TQWDTIPLLVLDVWEHAYYLQYKNNRGEYVDNWWDIVNWKDVENRFLKASELKWRPY
Download sequence
Identical sequences R9C2H6
WP_016203169.1.27975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]