SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R9JDJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R9JDJ3
Domain Number - Region: 34-63
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz beta-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R9JDJ3
Sequence length 139
Comment (tr|R9JDJ3|R9JDJ3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EOS32274.1} KW=Complete proteome; Reference proteome OX=397287 OS=Lachnospiraceae bacterium 28-4. GN=C807_00997 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MGKVSTNQKLQLIRSIREESQDNRMRMRHRERILYGIEHKAGDELPVYRKEYYEGGEGEL
YATEAGVPENGNSFSSFKLRMVLSVVLFCAFLAADASEGKIAGVSTEYVREEINKDFDAD
FEEVVFDFEDNFPYTLFMD
Download sequence
Identical sequences R9JDJ3
WP_016290799.1.52086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]