SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R9P201 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9P201
Domain Number 1 Region: 154-469
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.5e-66
Family Capz beta-1 subunit 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R9P201
Sequence length 473
Comment (tr|R9P201|R9P201_PSEHS) F-actin capping protein beta subunit {ECO:0000313|EMBL:GAC95343.1} KW=Complete proteome; Reference proteome OX=1305764 OS=Pseudozyma hubeiensis (strain SY62) (Yeast). GN=PHSY_002918 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Pseudozyma.
Sequence
MHSHVAKLAQTEEVGTVSRVIEGERAVGVDRDSKGVGGRVHLLASVQLERIEVRSKVGRH
CGTDKKLEQIFSKLVCADMLHGLSGSARSGAIQRGKDAADTITSTNGVLLLCRKLTDFLS
AFRSLVSAETFLYPTPGICWPLRRRGNCTSDMTDPLDLSLDLLRRLPPSKVEQNLDSIVK
LIPSYADDLYSSVDQPLKVKLDQSKQGSGREYLCCDYNKDGDSWRSWISDTYHPPITPSA
DDTADGEPGTRPSAPLRSLELKANDAFETYARLYYDNALSSVYLWDLDSDPSSLSGATVA
GTQAPSTFAGVVLLKKTIGQDGSNGISGAWDSIHVFEATERAGGGSKSASTGTGVSASYK
LTSTVMLGLVRRDEGAEDTSDLKPSSTKVGTVEIAGSLTRQSEADYALPDFVSHVSNVGR
MIEDMEAKMRNQLQEVYFGKTRDVVSHLRSTQSLEKERRAKDLQKELMGLWKK
Download sequence
Identical sequences R9P201
XP_012188930.1.99038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]