SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for S0B1D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S0B1D5
Domain Number 1 Region: 2-271
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.93e-80
Family Capz beta-1 subunit 0.000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S0B1D5
Sequence length 274
Comment (tr|S0B1D5|S0B1D5_ENTIV) F-actin-capping protein subunit beta, putative {ECO:0000313|EMBL:BAN41595.1} OX=33085 OS=Entamoeba invadens. GN= OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MTDKLDYALDLMRRLPPQKVEDNLQMLIDLCPDLTDELLSATDQPLKIVEDTQEKRSFLI
CDYCRDGDSYRSPFSNTYFPPFPEGNKPSAELRNLEKDLNEAFNMYREMYYEGGVHSVYV
WENDNDGFAVCVLMKKTADQSKKGNPMKGTWDSINVIEVIPKGKDKAEYRLTSTVILYLE
TNTEATGKVSFAGSLTRQNEKTLNVVGKDAHVVNIGEFVESTESTMRRILDAIYFSKSKE
ITNNCRCQMGSSQQAKINDITKAINTQLRGRKDD
Download sequence
Identical sequences A0A0A1TZ82 S0B1D5
XP_004253653.1.21224 jCVI|EIN_026790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]